Galectin 3/LGALS3 Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer:
ABB-A11198
- Bilder (8)
| Artikelname: | Galectin 3/LGALS3 Rabbit mAb, Unconjugated, Monoclonal |
| Artikelnummer: | ABB-A11198 |
| Hersteller Artikelnummer: | A11198 |
| Alternativnummer: | ABB-A11198-20UL,ABB-A11198-100UL,ABB-A11198-1000UL,ABB-A11198-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IHC-P, IP, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | L31, GAL3, MAC2, CBP35, GALBP, GALIG, LGALS2, Galectin 3/LGALS3 |
| This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix,the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis,innate immunity,cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants. |
| Klonalität: | Monoclonal |
| Klon-Bezeichnung: | [ARC0542] |
| Molekulargewicht: | 26kDa |
| NCBI: | 3958 |
| UniProt: | P17931 |
| Reinheit: | Affinity purification |
| Sequenz: | MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGA |
| Target-Kategorie: | LGALS3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:6000|IHC-P,1:200 - 1:800|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cell Biology Developmental Biology,Cell Cycle,Cell differentiation,Cell Adhesion,Neuroscience. Shipping: Ice Bag |
|
|
Immunohistochemistry analysis of paraffin-embedded Human colon tissue using Galectin 3/LGALS3 Rabbit mAb (A11198) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using Galectin 3/LGALS3 Rabbit mAb (A11198) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Western blot analysis of various lysates using Galectin 3/LGALS3 Rabbit mAb (A11198) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Galectin 3/LGALS3 Rabbit mAb (A11198) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Galectin 3/LGALS3 Rabbit mAb (A11198) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using Galectin 3/LGALS3 Rabbit mAb (A11198) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using Galectin 3/LGALS3 Rabbit mAb (A11198) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunoprecipitation analysis of 300 µg extracts of HT-29 cells using 3 µg Galectin 3/LGALS3 antibody (A11198). Western blot was performed from the immunoprecipitate using Galectin 3/LGALS3 antibody (A11198) at a dilution of 1:1000. |
Produktgarantie und fachkundiger Support
