G0S2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14125
Artikelname: G0S2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14125
Hersteller Artikelnummer: A14125
Alternativnummer: ABB-A14125-100UL,ABB-A14125-20UL,ABB-A14125-1000UL,ABB-A14125-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: G0S2
Involved in extrinsic apoptotic signaling pathway and positive regulation of extrinsic apoptotic signaling pathway. Located in mitochondrion.
Klonalität: Polyclonal
Molekulargewicht: 11kDa
NCBI: 50486
UniProt: P27469
Reinheit: Affinity purification
Sequenz: METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQ
Target-Kategorie: G0S2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Cancer. Shipping: Ice Bag
Western blot analysis of various lysates using G0S2 Rabbit pAb (A14125) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.