WNK1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A14196
- Bilder (1)
| Artikelname: | WNK1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A14196 |
| Hersteller Artikelnummer: | A14196 |
| Alternativnummer: | ABB-A14196-100UL,ABB-A14196-20UL,ABB-A14196-500UL,ABB-A14196-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KDP, PSK, p65, HSN2, HSAN2, PRKWNK1, PPP1R167, WNK1 |
| This gene encodes a member of the WNK subfamily of serine/threonine protein kinases. The encoded protein may be a key regulator of blood pressure by controlling the transport of sodium and chloride ions. Mutations in this gene have been associated with pseudohypoaldosteronism type II and hereditary sensory neuropathy type II. Alternatively spliced transcript variants encoding different isoforms have been described but the full-length nature of all of them has yet to be determined. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 251kDa |
| NCBI: | 65125 |
| UniProt: | Q9H4A3 |
| Reinheit: | Affinity purification |
| Sequenz: | MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHTMDKDSRGAAATTTTTEHRFFRRSVICDSNATALELPGLPLSLPQPSIPAAVPQSAPPEPHREETVTATATSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPPARSGSGGGSAKEPQEERSQQQDDIEELETK |
| Target-Kategorie: | WNK1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse,Rat. ResearchArea: Protein phosphorylation,Signal Transduction,Kinase. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using WNK1 Rabbit pAb (A14196) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
