AT1R/AGTR1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14201
Artikelname: AT1R/AGTR1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14201
Hersteller Artikelnummer: A14201
Alternativnummer: ABB-A14201-100UL,ABB-A14201-20UL,ABB-A14201-1000UL,ABB-A14201-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: AT1, AG2S, AT1B, AT1R, ATR1, AT1AR, AT1BR, AT2R1, HAT1R, AGTR1B, AT1R/AGTR1
Angiotensin II is a potent vasopressor hormone and a primary regulator of aldosterone secretion. It is an important effector controlling blood pressure and volume in the cardiovascular system. It acts through at least two types of receptors. This gene encodes the type 1 receptor which is thought to mediate the major cardiovascular effects of angiotensin II. This gene may play a role in the generation of reperfusion arrhythmias following restoration of blood flow to ischemic or infarcted myocardium. It was previously thought that a related gene, denoted as AGTR1B, existed, however, it is now believed that there is only one type 1 receptor gene in humans. Alternative splicing of this gene results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 41kDa
NCBI: 185
UniProt: P30556
Reinheit: Affinity purification
Sequenz: LIQLGIIRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPAPCFEVE
Target-Kategorie: AGTR1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism,Cardiovascular,Angiogenesis,Blood. Shipping: Ice Bag
Western blot analysis of various lysates, using AT1R/AGTR1 Rabbit pAb (A14201) at 1:1500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.