SLC6A2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A1421
- Bilder (1)
| Artikelname: | SLC6A2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A1421 |
| Hersteller Artikelnummer: | A1421 |
| Alternativnummer: | ABB-A1421-20UL,ABB-A1421-100UL,ABB-A1421-500UL,ABB-A1421-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | NET, NAT1, NET1, SLC6A5, SLC6A2 |
| This gene encodes a member of the sodium:neurotransmitter symporter family. This member is a multi-pass membrane protein, which is responsible for reuptake of norepinephrine into presynaptic nerve terminals and is a regulator of norepinephrine homeostasis. Mutations in this gene cause orthostatic intolerance, a syndrome characterized by lightheadedness, fatigue, altered mentation and syncope. Alternatively spliced transcript variants encoding different isoforms have been identified in this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 69kDa |
| NCBI: | 6530 |
| UniProt: | P23975 |
| Reinheit: | Affinity purification |
| Sequenz: | ELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS |
| Target-Kategorie: | SLC6A2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience,Cardiovascular. Shipping: Ice Bag |

