LSAMP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14248
Artikelname: LSAMP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14248
Hersteller Artikelnummer: A14248
Alternativnummer: ABB-A14248-100UL,ABB-A14248-20UL,ABB-A14248-500UL,ABB-A14248-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: LAMP, IGLON3, LSAMP
This gene encodes a member of the immunoglobulin LAMP, OBCAM and neurotrimin (IgLON) family of proteins. The encoded preproprotein is proteolytically processed to generate a neuronal surface glycoprotein. This protein may act as a selective homophilic adhesion molecule during axon guidance and neuronal growth in the developing limbic system. The encoded protein may also function as a tumor suppressor and may play a role in neuropsychiatric disorders. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed.
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 4045
UniProt: Q13449
Reinheit: Affinity purification
Sequenz: PTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGIN
Target-Kategorie: LSAMP
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Cell Adhesion,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates, using LSAMP Rabbit pAb (A14248) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.