CNTN6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14275
Artikelname: CNTN6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14275
Hersteller Artikelnummer: A14275
Alternativnummer: ABB-A14275-100UL,ABB-A14275-20UL,ABB-A14275-1000UL,ABB-A14275-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: NB3, CNTN6
The protein encoded by this gene is a member of the immunoglobulin superfamily. It is a glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein that functions as a cell adhesion molecule. It may play a role in the formation of axon connections in the developing nervous system. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 114kDa
NCBI: 27255
UniProt: Q9UQ52
Reinheit: Affinity purification
Sequenz: DGLLSRPIFTQEPHDVIFPLDLSKSEVILNCAANGYPSPHYRWKQNGTDIDFTMSYHYRLDGGSLAINSPHTDQDIGMYQCLATNLLGTIL
Target-Kategorie: CNTN6
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Cell Biology Developmental Biology,Cell Adhesion,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using CNTN6 Rabbit pAb (A14275) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.