TRMT112 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14310
Artikelname: TRMT112 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14310
Hersteller Artikelnummer: A14310
Alternativnummer: ABB-A14310-20UL,ABB-A14310-100UL,ABB-A14310-1000UL,ABB-A14310-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: TRM112, HSPC152, HSPC170, hTrm112, TRMT11-2, TRMT112
Enables protein heterodimerization activity and protein methyltransferase activity. Involved in macromolecule methylation and positive regulation of rRNA processing. Located in nucleoplasm and perinuclear region of cytoplasm. Part of protein-containing complex.
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 51504
UniProt: Q9UI30
Reinheit: Affinity purification
Sequenz: MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES
Target-Kategorie: TRMT112
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Amino acid metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using TRMT112 Rabbit pAb (A14310) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.