PARP12 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A14317
- Bilder (1)
| Artikelname: | PARP12 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A14317 |
| Hersteller Artikelnummer: | A14317 |
| Alternativnummer: | ABB-A14317-100UL,ABB-A14317-20UL,ABB-A14317-500UL,ABB-A14317-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ZC3H1, ARTD12, MST109, MSTP109, ZC3HDC1, PARP12 |
| Enables protein ADP-ribosylase activity. Involved in protein auto-ADP-ribosylation and protein mono-ADP-ribosylation. Predicted to be located in nucleus. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 79kDa |
| NCBI: | 64761 |
| UniProt: | Q9H0J9 |
| Reinheit: | Affinity purification |
| Sequenz: | YVSPQDVTTMQTCNTKFPGPKSIPDYWDSSALPDPGFQKITLSSSSEEYQKVWNLFNRTLPFYFVQKIERVQNLALWEVYQWQKGQMQKQNGGKAVDERQLFHGTSAIFVDAICQQNFDWRVCGVHGTSYGKGSYFARDAAYSHHYSKSDTQTHTMFLARVLVGEFVRGNASFVRPPAKEGWSNAFYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSLFSSRQ |
| Target-Kategorie: | PARP12 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using PARP12 Rabbit pAb (A14317) at 1:3000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Produktgarantie und fachkundiger Support
