TSPAN15 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14395
Artikelname: TSPAN15 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14395
Hersteller Artikelnummer: A14395
Alternativnummer: ABB-A14395-20UL,ABB-A14395-100UL,ABB-A14395-500UL,ABB-A14395-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: NET7, NET-7, TM4SF15, 2700063A19Rik, TSPAN15
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The use of alternate polyadenylation sites has been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 33kDa
NCBI: 23555
UniProt: O95858
Reinheit: Affinity purification
Sequenz: GVVALTFRNQTIDFLNDNIRRGIENYYDDLDFKNIMDFVQKKFKCCGGEDYRDWSKNQYHDCSAPGPLACGVPYTCCIRNTTEVVNTMCGYKTIDKERFSVQDVIYVRGCT
Target-Kategorie: TSPAN15
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of lysates from mouse spleen, using TSPAN15 Rabbit pAb (A14395) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.