MIIP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14417
Artikelname: MIIP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14417
Hersteller Artikelnummer: A14417
Alternativnummer: ABB-A14417-20UL,ABB-A14417-100UL,ABB-A14417-1000UL,ABB-A14417-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: IIP45, MIIP
This gene encodes a protein that interacts with the oncogene protein insulin-like growth factor binding protein 2 and may function as an inhibitor of cell migration and invasion. This protein also interacts with the cell division protein 20 and may be involved in regulating mitotic progression. This protein may function as a tumor suppressor by inhibiting the growth or certain cancers.
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 60672
UniProt: Q5JXC2
Reinheit: Affinity purification
Sequenz: AHVRVSIPLSILEPPHRYHIHRRKSFDASDTLALPRHCLLGWDIFPPKSEKSSAPRNLDLWSSVSAEAQHQKLSGTSSPFHPASPMQMLPPTPTWSVPQVPRPHVPRQKP
Target-Kategorie: MIIP
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Rat. ResearchArea: Cancer,Invasion and Metastasis,Cell Biology Developmental Biology,Cell Adhesion,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates, using MIIP Rabbit pAb (A14417) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.