MCEE Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A14430
- Bilder (1)
| Artikelname: | MCEE Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A14430 |
| Hersteller Artikelnummer: | A14430 |
| Alternativnummer: | ABB-A14430-100UL,ABB-A14430-20UL,ABB-A14430-1000UL,ABB-A14430-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MCE, MMCE, GLOD2, MCEE |
| The product of this gene catalyzes the interconversion of D- and L-methylmalonyl-CoA during the degradation of branched chain amino acids. odd chain-length fatty acids, and other metabolites. Mutations in this gene result in methylmalonyl-CoA epimerase deficiency, which is presented as mild to moderate methylmalonic aciduria. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 19kDa |
| NCBI: | 84693 |
| UniProt: | Q96PE7 |
| Reinheit: | Affinity purification |
| Sequenz: | MARVLKAAAANAVGLFSRLQAPIPTVRASSTSQPLDQVTGSVWNLGRLNHVAIAVPDLEKAAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGRDSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA |
| Target-Kategorie: | MCEE |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using MCEE Rabbit pAb (A14430) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 5s. |
Produktgarantie und fachkundiger Support
