ALDH1L2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A14455
- Bilder (1)
| Artikelname: | ALDH1L2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A14455 |
| Hersteller Artikelnummer: | A14455 |
| Alternativnummer: | ABB-A14455-100UL,ABB-A14455-20UL,ABB-A14455-1000UL,ABB-A14455-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | mtFDH, ALDH1L2 |
| This gene encodes a member of both the aldehyde dehydrogenase superfamily and the formyl transferase superfamily. This member is the mitochondrial form of 10-formyltetrahydrofolate dehydrogenase (FDH), which converts 10-formyltetrahydrofolate to tetrahydrofolate and CO2 in an NADP(+)-dependent reaction, and plays an essential role in the distribution of one-carbon groups between the cytosolic and mitochondrial compartments of the cell. Alternatively spliced transcript variants have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 102kDa |
| NCBI: | 160428 |
| UniProt: | Q3SY69 |
| Reinheit: | Affinity purification |
| Sequenz: | EPLEIKGAKKPGLVTKNGLVLFGNDGKALTVRNLQFEDGKMIPASQYFSTGETSVVELTAEEVKVAETIKVIWAGILSNVPIIEDSTDFFKSGASSMDVARLVEEIRQKCGGLQLQNEDVYMATKFEGFIQKVVRKLRGEDQEVELVVDYISKEVNEIMVKMPYQCFINGQFTDADDGKTYDTINPTDGSTICKVSYASLA |
| Target-Kategorie: | ALDH1L2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Amino acid metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ALDH1L2 Rabbit pAb (A14455) at 1:3000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Produktgarantie und fachkundiger Support
