POMGNT2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14518
Artikelname: POMGNT2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14518
Hersteller Artikelnummer: A14518
Alternativnummer: ABB-A14518-100UL,ABB-A14518-20UL,ABB-A14518-500UL,ABB-A14518-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: AGO61, GTDC2, MDDGA8, MDDGC8, C3orf39, POMGNT2
This gene encodes a protein with glycosyltransferase activity although its function is not currently known.
Klonalität: Polyclonal
Molekulargewicht: 67kDa
NCBI: 84892
UniProt: Q8NAT1
Reinheit: Affinity purification
Sequenz: NPDNLMHVFHDDLLPLFYTLRQFPGLAHEARLFFMEGWGEGAHFDLYKLLSPKQPLLRAQLKTLGRLLCFSHAFVGLSKITTWYQYGFVQPQGPKANILVSGNEIRQFARFMTEKLNVSHTGVPLGEEYILVFSRTQNRLILNEAELLLALAQEFQMKTVTVSLEDHTFADVVRLVSNASM
Target-Kategorie: POMGNT2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using POMGNT2 Rabbit pAb (A14518) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.