FBXL12 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A14589
- Bilder (1)
| Artikelname: | FBXL12 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A14589 |
| Hersteller Artikelnummer: | A14589 |
| Alternativnummer: | ABB-A14589-100UL,ABB-A14589-20UL,ABB-A14589-500UL,ABB-A14589-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Fbl12, FBXL12 |
| Members of the F-box protein family, such as FBXL12, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1, MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 37kDa |
| NCBI: | 54850 |
| UniProt: | Q9NXK8 |
| Reinheit: | Affinity purification |
| Sequenz: | MATLVELPDSVLLEIFSYLPVRDRIRISRVCHRWKRLVDDRWLWRHVDLTLYTMRPKVMWHLLRRYMASRLHSLRMGGYLFSGSQAPQLSPALLRALGQKCPNLKRLCLHVADLSMVPITSLPSTLRTLELHSCEISMAWLHKQQDPTVLPLLECIVLDRVPAFRDEHLQGLTRFRALRSLVLGGTYRVTETGLDAGLQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRKIRLTVRGLSAPGLAVLEGMPALE |
| Target-Kategorie: | FBXL12 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Ubiquitin. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using FBXL12 Rabbit pAb (A14589) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
