Butyrylcholinesterase Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A1460
- Bilder (1)
| Artikelname: | Butyrylcholinesterase Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A1460 |
| Hersteller Artikelnummer: | A1460 |
| Alternativnummer: | ABB-A1460-100UL,ABB-A1460-20UL,ABB-A1460-1000UL,ABB-A1460-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | E1, CHE1, CHE2, BCHED, Butyrylcholinesterase |
| This gene encodes a cholinesterase enzyme and member of the type-B carboxylesterase/lipase family of proteins. The encoded enzyme exhibits broad substrate specificity and is involved in the detoxification of poisons including organophosphate nerve agents and pesticides, and the metabolism of drugs including cocaine, heroin and aspirin. Humans homozygous for certain mutations in this gene exhibit prolonged apnea after administration of the muscle relaxant succinylcholine. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 68kDa |
| NCBI: | 590 |
| UniProt: | P06276 |
| Reinheit: | Affinity purification |
| Sequenz: | EDDIIIATKNGKVRGMNLTVFGGTVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQSFPGFHGSEMWNPNTDLSEDCLYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEARNR |
| Target-Kategorie: | BCHE |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Drug metabolism,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease. Shipping: Ice Bag |

