CDSN Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14602
Artikelname: CDSN Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14602
Hersteller Artikelnummer: A14602
Alternativnummer: ABB-A14602-20UL,ABB-A14602-100UL,ABB-A14602-500UL,ABB-A14602-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PSS, HTSS, PSS1, HTSS1, HYPT2, CDSN
This gene encodes a protein found in corneodesmosomes, which localize to human epidermis and other cornified squamous epithelia. The encoded protein undergoes a series of cleavages during corneocyte maturation. This gene is highly polymorphic in human populations, and variation has been associated with skin diseases such as psoriasis, hypotrichosis and peeling skin syndrome. The gene is located in the major histocompatibility complex (MHC) class I region on chromosome 6.
Klonalität: Polyclonal
Molekulargewicht: 52kDa
NCBI: 1041
UniProt: Q15517
Reinheit: Affinity purification
Sequenz: GGSAGSFKPGTGYSQVSYSSGSGSSLQGASGSSQLGSSSSHSGSSGSHSGSSSSHSSSSSSFQFSSSSFQVGNGSALPTNDNSYRGILNPSQPGQSSSSSQ
Target-Kategorie: CDSN
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix. Shipping: Ice Bag
Western blot analysis of various lysates using CDSN Rabbit pAb (A14602) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.