RYBP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A14605
- Bilder (1)
| Artikelname: | RYBP Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A14605 |
| Hersteller Artikelnummer: | A14605 |
| Alternativnummer: | ABB-A14605-100UL,ABB-A14605-20UL,ABB-A14605-500UL,ABB-A14605-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | AAP1, DEDAF, YEAF1, APAP-1, RYBP |
| Predicted to enable DNA binding activity and transcription coregulator activity. Involved in several processes, including histone H2A monoubiquitination, negative regulation of proteasomal ubiquitin-dependent protein catabolic process, and positive regulation of transcription, DNA-templated. Located in nucleoplasm. Colocalizes with PcG protein complex. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 25kDa |
| NCBI: | 23429 |
| UniProt: | Q8N488 |
| Reinheit: | Affinity purification |
| Sequenz: | PSVTKKNTNKKTKPKSDILKDPPSEANSIQSANATTKTSETNHTSRPRLKNVDRSTAQQLAVTVGNVTVIITDFKEKTRSSSTSSSTVTSSAGSEQQNQSSSGSESTDKGSSRSSTPKGDMSAVNDESF |
| Target-Kategorie: | RYBP |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Apoptosis. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using RYBP Rabbit pAb (A14605) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Produktgarantie und fachkundiger Support
