Alcohol Dehydrogenase Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14701
Artikelname: Alcohol Dehydrogenase Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14701
Hersteller Artikelnummer: A14701
Alternativnummer: ABB-A14701-100UL,ABB-A14701-20UL,ABB-A14701-1000UL,ABB-A14701-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ADH1A, ADH1, Alcohol Dehydrogenase
This gene encodes a member of the alcohol dehydrogenase family. The encoded protein is the alpha subunit of class I alcohol dehydrogenase, which consists of several homo- and heterodimers of alpha, beta and gamma subunits. Alcohol dehydrogenases catalyze the oxidation of alcohols to aldehydes. This gene is active in the liver in early fetal life but only weakly active in adult liver. This gene is found in a cluster with six additional alcohol dehydrogenase genes, including those encoding the beta and gamma subunits, on the long arm of chromosome 4. Mutations in this gene may contribute to variation in certain personality traits and substance dependence.
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 124
UniProt: P07327
Reinheit: Affinity purification
Sequenz: IIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQ
Target-Kategorie: ADH1A
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using Alcohol Dehydrogenase Rabbit pAb (A14701) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.