ATP6V1A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14707
Artikelname: ATP6V1A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14707
Hersteller Artikelnummer: A14707
Alternativnummer: ABB-A14707-20UL,ABB-A14707-100UL,ABB-A14707-500UL,ABB-A14707-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HO68, VA68, VPP2, Vma1, DEE93, ARCL2D, ATP6A1, IECEE3, ATP6V1A1, ATP6V1A
This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c, c, and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of two V1 domain A subunit isoforms and is found in all tissues. Transcript variants derived from alternative polyadenylation exist.
Klonalität: Polyclonal
Molekulargewicht: 68kDa
NCBI: 523
UniProt: P38606
Reinheit: Affinity purification
Sequenz: SLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAFYDMARRAVETTAQSDNKITWSIIREHMGDILYKLSSMKFKDPLKDGEAKIKSD
Target-Kategorie: ATP6V1A
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Signal Transduction,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of lysates from mouse brain, using ATP6V1A Rabbit pAb (A14707) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.