CACNB3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A14710
- Bilder (1)
| Artikelname: | CACNB3 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A14710 |
| Hersteller Artikelnummer: | A14710 |
| Alternativnummer: | ABB-A14710-20UL,ABB-A14710-100UL,ABB-A14710-500UL,ABB-A14710-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CAB3, CACNLB3, CACNB3 |
| This gene encodes a regulatory beta subunit of the voltage-dependent calcium channel. Beta subunits are composed of five domains, which contribute to the regulation of surface expression and gating of calcium channels and may also play a role in the regulation of transcription factors and calcium transport. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 55kDa |
| NCBI: | 784 |
| UniProt: | P54284 |
| Reinheit: | Affinity purification |
| Sequenz: | VYWRATHHPAPGPGLLGPPSAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDSY |
| Target-Kategorie: | CACNB3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse,Rat. ResearchArea: Neuroscience,Calcium Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using CACNB3 Rabbit pAb (A14710) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
