FGF4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14731
Artikelname: FGF4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14731
Hersteller Artikelnummer: A14731
Alternativnummer: ABB-A14731-20UL,ABB-A14731-100UL,ABB-A14731-1000UL,ABB-A14731-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HST, KFGF, FGF-4, HST-1, HSTF1, K-FGF, HBGF-4, HSTF-1, FGF4
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified by its oncogenic transforming activity. This gene and FGF3, another oncogenic growth factor, are located closely on chromosome 11. Co-amplification of both genes was found in various kinds of human tumors. Studies on the mouse homolog suggested a function in bone morphogenesis and limb development through the sonic hedgehog (SHH) signaling pathway.
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 2249
UniProt: P08620
Reinheit: Affinity purification
Sequenz: APTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
Target-Kategorie: FGF4
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Growth factors,Stem Cells,Cardiovascular,Angiogenesis. Shipping: Ice Bag
Western blot analysis of lysates from rat liver, using FGF4 Rabbit pAb (A14731) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.