ISG20 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14744
Artikelname: ISG20 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14744
Hersteller Artikelnummer: A14744
Alternativnummer: ABB-A14744-100UL,ABB-A14744-20UL,ABB-A14744-500UL,ABB-A14744-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CD25, HEM45, ISG20
Enables 3-5 exonuclease activity and RNA binding activity. Involved in defense response to virus, negative regulation of viral genome replication, and nucleobase-containing compound catabolic process. Located in cytoplasm and nuclear lumen.
Klonalität: Polyclonal
Molekulargewicht: 20kDa
NCBI: 3669
UniProt: Q96AZ6
Reinheit: Affinity purification
Sequenz: MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPF
Target-Kategorie: ISG20
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Immunology Inflammation,Cytokines,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using ISG20 Rabbit pAb (A14744) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.