PCDH9 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A14760
- Bilder (1)
| Artikelname: | PCDH9 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A14760 |
| Hersteller Artikelnummer: | A14760 |
| Alternativnummer: | ABB-A14760-20UL,ABB-A14760-100UL,ABB-A14760-500UL,ABB-A14760-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PCDH9 |
| This gene encodes a member of the protocadherin family, and cadherin superfamily, of transmembrane proteins containing cadherin domains. These proteins mediate cell adhesion in neural tissues in the presence of calcium. The encoded protein may be involved in signaling at neuronal synaptic junctions. Sharing a characteristic with other protocadherin genes, this gene has a notably large exon that encodes multiple cadherin domains and a transmembrane region. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 136kDa |
| NCBI: | 5101 |
| UniProt: | Q9HC56 |
| Reinheit: | Affinity purification |
| Sequenz: | ICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDAD |
| Target-Kategorie: | PCDH9 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using PCDH9 Rabbit pAb (A14760) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
