RBBP6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14776
Artikelname: RBBP6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14776
Hersteller Artikelnummer: A14776
Alternativnummer: ABB-A14776-100UL,ABB-A14776-20UL,ABB-A14776-500UL,ABB-A14776-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PACT, MY038, P2P-R, RBQ-1, SNAMA, RBBP6
The retinoblastoma tumor suppressor (pRB) protein binds with many other proteins. In various human cancers, pRB suppresses cellular proliferation and is inactivated. Cell cycle-dependent phosphorylation regulates the activity of pRB. This gene encodes a protein which binds to underphosphorylated but not phosphorylated pRB. Multiple alternatively spliced transcript variants that encode different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 202kDa
NCBI: 5930
UniProt: Q7Z6E9
Reinheit: Affinity purification
Sequenz: SKVKQEKVKGKVRRKVTGTEGSSSTLVDYTSTSSTGGSPVRKSEEKTDTKRTVIKTMEEYNNDNTAPAEDVIIMIQVPQSKWDKDDFESEEEDVKSTQPISSVGKPASVIKNVSTK
Target-Kategorie: RBBP6
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Tumor biomarkers,Tumor suppressors,p53 pathway,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Cell cycle inhibitors. Shipping: Ice Bag
Western blot analysis of lysates from K-562 cells, using RBBP6 Rabbit pAb (A14776) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.