SRD5A1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14787
Artikelname: SRD5A1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14787
Hersteller Artikelnummer: A14787
Alternativnummer: ABB-A14787-100UL,ABB-A14787-20UL,ABB-A14787-500UL,ABB-A14787-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: S5AR 1, SRD5A1
Steroid 5-alpha-reductase (EC 1.3.99.5) catalyzes the conversion of testosterone into the more potent androgen, dihydrotestosterone (DHT). Also see SRD5A2 (MIM 607306).
Klonalität: Polyclonal
Molekulargewicht: 29kDa
NCBI: 6715
UniProt: P18405
Reinheit: Affinity purification
Sequenz: LIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYF
Target-Kategorie: SRD5A1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from Mouse skin, using SRD5A1 Rabbit pAb (A14787) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.