ZNF177 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14803
Artikelname: ZNF177 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14803
Hersteller Artikelnummer: A14803
Alternativnummer: ABB-A14803-100UL,ABB-A14803-20UL,ABB-A14803-1000UL,ABB-A14803-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PIGX, ZNF177
Enables sequence-specific double-stranded DNA binding activity. Predicted to be involved in negative regulation of transcription by RNA polymerase II. Located in blood microparticle.
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 7730
UniProt: Q13360
Reinheit: Affinity purification
Sequenz: LASVGYQLCRHSLISKVDQEQLKTDERGILQGDCADWETQLKPKDTIAMQNIPGGKTSNGI
Target-Kategorie: ZNF177
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of lysates from mouse testis, using ZNF177 Rabbit pAb (A14803) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 2.5min.