PRPF4B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A14815
- Bilder (1)
| Artikelname: | PRPF4B Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A14815 |
| Hersteller Artikelnummer: | A14815 |
| Alternativnummer: | ABB-A14815-100UL,ABB-A14815-20UL,ABB-A14815-500UL,ABB-A14815-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PR4H, PRP4, PRP4H, PRP4K, dJ1013A10.1, PRPF4B |
| Pre-mRNA splicing occurs in two sequential transesterification steps, and the protein encoded by this gene is thought to be involved in pre-mRNA splicing and in signal transduction. This protein belongs to a kinase family that includes serine/arginine-rich protein-specific kinases and cyclin-dependent kinases (CDKs). This protein is regarded as a CDK-like kinase (Clk) with homology to mitogen-activated protein kinases (MAPKs). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 117kDa |
| NCBI: | 8899 |
| UniProt: | Q13523 |
| Reinheit: | Affinity purification |
| Sequenz: | QKYKYLAEDSNMSVPSEPSSPQSSTRTRSPSPDDILERVAADVKEYERENVDTFEASVKAKHNLMTVEQNNGSSQKKLLAPDMFTESDDMFAAYFDSARLRAAGIGKDFKENPNLRDNWTDAEGYYRVNIGEVLDKRYNVYGYTGQGVFSNVVRARDNARANQEVAVKIIRNNELMQKTGLKELEFLKKLNDADPDDKFHCLRLFRHFYHK |
| Target-Kategorie: | PRPF4B |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Kinase. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using PRPF4B Rabbit pAb (A14815) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Produktgarantie und fachkundiger Support
