FAM127A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14816
Artikelname: FAM127A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14816
Hersteller Artikelnummer: A14816
Alternativnummer: ABB-A14816-20UL,ABB-A14816-100UL,ABB-A14816-1000UL,ABB-A14816-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CXX1, Mar8, MAR8C, Mart8, SIRH5, MART8C, FAM127A
Predicted to be located in plasma membrane.
Klonalität: Polyclonal
Molekulargewicht: 13kDa
NCBI: 8933
UniProt: A6ZKI3
Reinheit: Affinity purification
Sequenz: MDGRVQLIKALLALPIRPATRRWRNPIPFPETFDGDTDRLPEFIVQTGSYMFVDENTFSSDALKVTFLITRLTGPALQWVIPYIKKESPLLNDYRGFLAEMKRVFGWEEDEDF
Target-Kategorie: RTL8C
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using FAM127A Rabbit pAb (A14816) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.