SIGMAR1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14837
Artikelname: SIGMAR1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14837
Hersteller Artikelnummer: A14837
Alternativnummer: ABB-A14837-100UL,ABB-A14837-20UL,ABB-A14837-1000UL,ABB-A14837-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SRBP, ALS16, DSMA2, OPRS1, SR-BP, SIG-1R, SR-BP1, sigma1R, hSigmaR1, SIGMAR1
This gene encodes a receptor protein that interacts with a variety of psychotomimetic drugs, including cocaine and amphetamines. The receptor is believed to play an important role in the cellular functions of various tissues associated with the endocrine, immune, and nervous systems. As indicated by its previous name, opioid receptor sigma 1 (OPRS1), the product of this gene was erroneously thought to function as an opioid receptor, it is now thought to be a non-opioid receptor. Mutations in this gene has been associated with juvenile amyotrophic lateral sclerosis 16. Alternative splicing of this gene results in transcript variants encoding distinct isoforms.
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 10280
UniProt: Q99720
Reinheit: Affinity purification
Sequenz: GTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQ
Target-Kategorie: SIGMAR1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Rat. ResearchArea: Cancer,Tumor biomarkers,Signal Transduction,Endocrine Metabolism,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease,Cardiovascular,Heart,Hypertrophy. Shipping: Ice Bag
Western blot analysis of lysates from HeLa cells, using SIGMAR1 Rabbit pAb (A14837) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.