CGREF1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14844
Artikelname: CGREF1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14844
Hersteller Artikelnummer: A14844
Alternativnummer: ABB-A14844-100UL,ABB-A14844-20UL,ABB-A14844-500UL,ABB-A14844-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CGR11, CGREF1
Predicted to enable calcium ion binding activity. Predicted to be involved in negative regulation of cell population proliferation. Predicted to be located in extracellular region.
Klonalität: Polyclonal
Molekulargewicht: 33kDa
NCBI: 10669
UniProt: Q99674
Reinheit: Affinity purification
Sequenz: APKDGVTRPDSEVQHQLLPNPFQPGQEQLGLLQSYLKGLGRTEVQLEHLSREQVLLYLFALHDYDQSGQLDGLELLSMLTAALAPGAANSPTTNPVILIVDKVLETQDLNGDGLMTPAELINFPGVALRHVEPGEPLAPSPQEPQAVGRQSLLAKSPLRQETQEAPGPREEAKGQVEARRE
Target-Kategorie: CGREF1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Cell cycle inhibitors. Shipping: Ice Bag
Western blot analysis of various lysates using CGREF1 Rabbit pAb (A14844) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.