EBP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14845
Artikelname: EBP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14845
Hersteller Artikelnummer: A14845
Alternativnummer: ABB-A14845-100UL,ABB-A14845-20UL,ABB-A14845-1000UL,ABB-A14845-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CPX, CHO2, CPXD, MEND, CDPX2, EBP
The protein encoded by this gene is an integral membrane protein of the endoplasmic reticulum. It is a high affinity binding protein for the antiischemic phenylalkylamine Ca2+ antagonist [3H]emopamil and the photoaffinity label [3H]azidopamil. It is similar to sigma receptors and may be a member of a superfamily of high affinity drug-binding proteins in the endoplasmic reticulum of different tissues. This protein shares structural features with bacterial and eukaryontic drug transporting proteins. It has four putative transmembrane segments and contains two conserved glutamate residues which may be involved in the transport of cationic amphiphilics. Another prominent feature of this protein is its high content of aromatic amino acid residues (>23%) in its transmembrane segments. These aromatic amino acid residues have been suggested to be involved in the drug transport by the P-glycoprotein. Mutations in this gene cause Chondrodysplasia punctata 2 (CDPX2, also known as Conradi-Hunermann syndrome).
Klonalität: Polyclonal
Molekulargewicht: 26kDa
NCBI: 10682
UniProt: Q15125
Reinheit: Affinity purification
Sequenz: SGRAAVVPLGTWRRLSLCWFAVCGFIHLVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVCMETITACLWGPLSLWVVIAFLRQHPLRFIL
Target-Kategorie: EBP
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Tumor biomarkers,Signal Transduction,Kinase,Tyrosine kinases,Endocrine Metabolism,Lipid Metabolism,Cholesterol Metabolism,Drug metabolism,Cardiovascular,Lipids. Shipping: Ice Bag
Western blot analysis of various lysates using EBP Rabbit pAb (A14845) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.