ZNF273 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14847
Artikelname: ZNF273 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14847
Hersteller Artikelnummer: A14847
Alternativnummer: ABB-A14847-20UL,ABB-A14847-100UL,ABB-A14847-500UL,ABB-A14847-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HZF9, ZNF273
This gene is a member of the krueppel C2H2-type zinc-finger protein family and encodes a protein with 13 C2H2-type zinc fingers and a KRAB domain. This nuclear protein is involved in transcriptional regulation. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 65kDa
NCBI: 10793
UniProt: Q14593
Reinheit: Affinity purification
Sequenz: ECGKSCCILSQLTQHKKTATRVNFYKCKTCGKAFNQFSNLTKHKIIHPEVN
Target-Kategorie: ZNF273
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of various lysates, using ZNF273 Rabbit pAb (A14847) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.