NOS1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A1485
- Bilder (1)
| Artikelname: | NOS1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A1485 |
| Hersteller Artikelnummer: | A1485 |
| Alternativnummer: | ABB-A1485-20UL,ABB-A1485-100UL,ABB-A1485-500UL,ABB-A1485-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | NOS, bNOS, nNOS, IHPS1, N-NOS, NC-NOS, NOS1 |
| The protein encoded by this gene belongs to the family of nitric oxide synthases, which synthesize nitric oxide from L-arginine. Nitric oxide is a reactive free radical, which acts as a biologic mediator in several processes, including neurotransmission, and antimicrobial and antitumoral activities. In the brain and peripheral nervous system, nitric oxide displays many properties of a neurotransmitter, and has been implicated in neurotoxicity associated with stroke and neurodegenerative diseases, neural regulation of smooth muscle, including peristalsis, and penile erection. This protein is ubiquitously expressed, with high level of expression in skeletal muscle. Multiple transcript variants that differ in the 5 UTR have been described for this gene but the full-length nature of these transcripts is not known. Additionally, alternatively spliced transcript variants encoding different isoforms (some testis-specific) have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 161kDa |
| NCBI: | 4842 |
| UniProt: | P29475 |
| Reinheit: | Affinity purification |
| Sequenz: | MEDHMFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNGRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAVDLSHQPPAGKEQPLAVDGASGPGNGPQHAYDDGQEAGSLPHANGLAP |
| Target-Kategorie: | NOS1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Rat. ResearchArea: Cancer,Signal Transduction,MAPK-Erk Signaling Pathway,Endocrine Metabolism,Neuroscience,Neurodegenerative Diseases,Cardiovascular,Angiogenesis. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from rat liver, using NOS1 Rabbit pAb (A1485) at 1:2000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
Produktgarantie und fachkundiger Support
