FGGY Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A14904
- Bilder (1)
| Artikelname: | FGGY Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A14904 |
| Hersteller Artikelnummer: | A14904 |
| Alternativnummer: | ABB-A14904-20UL,ABB-A14904-100UL,ABB-A14904-500UL,ABB-A14904-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FGGY |
| This gene encodes a protein that phosphorylates carbohydrates such as ribulose, ribitol, and L-arabinitol. Genome-wide association studies in some populations have found an association between polymorphisms in this gene and sporadic amyotrophic lateral sclerosis, but studies of other populations have not been able to replicate this association. Alternative splicing results in multiple transcript variants. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 60kDa |
| NCBI: | 55277 |
| UniProt: | Q96C11 |
| Reinheit: | Affinity purification |
| Sequenz: | MSGGEQKPERYYVGVDVGTGSVRAALVDQSGVLLAFADQPIKNWEPQFNHHEQSSEDIWAACCVVTKKVVQGIDLNQIRGLGFDATCSLVVLDKQFHPLPVNQEGDSHRNVIMWLDHRAVSQVNRINETKHSVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLSWKATGVTARSLCSLVCKWTYSAEKGWDDSFWKMIGLEDFVADNYSKIGNQVLPPGASLGNGLTPEAARDLGLLP |
| Target-Kategorie: | FGGY |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Kinase,Neuroscience,Neurodegenerative Diseases,Other Neurological disorders. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using FGGY Rabbit pAb (A14904) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
