RMND5A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14924
Artikelname: RMND5A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14924
Hersteller Artikelnummer: A14924
Alternativnummer: ABB-A14924-100UL,ABB-A14924-20UL,ABB-A14924-500UL,ABB-A14924-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CTLH, GID2, RMD5, GID2A, p44CTLH, RMND5A
Predicted to enable metal ion binding activity and ubiquitin protein ligase activity. Predicted to contribute to ubiquitin-protein transferase activity. Predicted to be involved in proteasome-mediated ubiquitin-dependent protein catabolic process and protein polyubiquitination. Located in cytoplasm and nucleoplasm. Part of ubiquitin ligase complex.
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 64795
UniProt: Q9H871
Reinheit: Affinity purification
Sequenz: ISLLMGGTTNQREALQYAKNFQPFALNHQKDIQVLMGSLVYLRQGIENSPYVHLLDANQWADICDIFTRDA
Target-Kategorie: RMND5A
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Cytoskeleton,Microtubules. Shipping: Ice Bag
Western blot analysis of various lysates using RMND5A Rabbit pAb (A14924) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.