FNDC4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14925
Artikelname: FNDC4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14925
Hersteller Artikelnummer: A14925
Alternativnummer: ABB-A14925-100UL,ABB-A14925-20UL,ABB-A14925-500UL,ABB-A14925-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: FRCP1, FNDC4
Involved in response to transforming growth factor beta. Predicted to be located in endoplasmic reticulum and extracellular space. Predicted to be active in extracellular region and plasma membrane.
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 64838
UniProt: Q9H6D8
Reinheit: Affinity purification
Sequenz: DRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQT
Target-Kategorie: FNDC4
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of lysates from HUVEC cells, using FNDC4 Rabbit pAb (A14925) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.