CBLL1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A14932
- Bilder (1)
| Artikelname: | CBLL1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A14932 |
| Hersteller Artikelnummer: | A14932 |
| Alternativnummer: | ABB-A14932-20UL,ABB-A14932-100UL,ABB-A14932-500UL,ABB-A14932-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HAKAI, RNF188, CBLL1 |
| This gene encodes an E3 ubiquitin-ligase for the E-cadherin complex and mediates its ubiquitination, endocytosis, and degradation in the lysosomes. The encoded protein contains a RING-finger domain and is also thought to have a role in control of cell proliferation. A related pseudogene has been identified on chromosome X. Alternative splicing results in a non-coding transcript variant. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 55kDa |
| NCBI: | 79872 |
| UniProt: | Q75N03 |
| Reinheit: | Affinity purification |
| Sequenz: | MDHTDNELQGTNSSGSLGGLDVRRRIPIKLISKQANKAKPAPRTQRTINRMPAKAPPGDEEGFDYNEEERYDCKGGELFANQRRFPGHLFWDFQINILGEKDDTPVHFCDKCGLPIKIYGRMIPCKHVFCYDCAILHEKKGDKMCPGCSDPVQRIEQCTRGSLFMCSIVQGCKRTYLSQRDLQAHINHRHMRAGKPVTRASLENVHPPIAPPPTEIPERFIMPPDKHHMSHIPPKQHIMM |
| Target-Kategorie: | CBLL1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Ubiquitin. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using CBLL1 Rabbit pAb (A14932) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
