RASSF4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14943
Artikelname: RASSF4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14943
Hersteller Artikelnummer: A14943
Alternativnummer: ABB-A14943-20UL,ABB-A14943-100UL,ABB-A14943-500UL,ABB-A14943-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: AD037, RASSF4
The function of this gene has not yet been determined but may involve a role in tumor suppression. Alternative splicing of this gene results in several transcript variants, however, most of the variants have not been fully described.
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 83937
UniProt: Q9H2L5
Reinheit: Affinity purification
Sequenz: MKEDCLPSSHVPISDSKSIQKSELLGLLKTYNCYHEGKSFQLRHREEEGTLIIEGLLNIAWGLRRPIRLQMQDDREQVHLPSTSWMPRRPSCPLKEPSPQNGNITAQGPSIQPVHKAESSTDSSGPLEEAEEAPQLMRTKSDASCMSQRRPKCRAPGEAQ
Target-Kategorie: RASSF4
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor suppressors,Signal Transduction,G protein signaling,Small G proteins,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Cell cycle inhibitors. Shipping: Ice Bag
Western blot analysis of various lysates using RASSF4 Rabbit pAb (A14943) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.