ZNF677 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14981
Artikelname: ZNF677 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14981
Hersteller Artikelnummer: A14981
Alternativnummer: ABB-A14981-100UL,ABB-A14981-20UL,ABB-A14981-1000UL,ABB-A14981-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ZNF677
Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to be active in nucleus.
Klonalität: Polyclonal
Molekulargewicht: 68kDa
NCBI: 342926
UniProt: Q86XU0
Reinheit: Affinity purification
Sequenz: DNIPPEDDISVGFTSKGLSPKENNKEELYHLVILERKESHGINNFDLKEVWENMPKFDSLWDYDVKNYKGMPLTCNKNLTHRKDQQHNKSSIHFSLKQSVSIRDSAHQYFIHDKPFIRNLLKLKNNIRYAGNKYVKCFENKIGLSLQAQLA
Target-Kategorie: ZNF677
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of lysates from rat testis, using ZNF677 Rabbit pAb (A14981) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.