CAS9 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A14997
- Bilder (1)
| Artikelname: | CAS9 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A14997 |
| Hersteller Artikelnummer: | A14997 |
| Alternativnummer: | ABB-A14997-100UL,ABB-A14997-20UL,ABB-A14997-500UL,ABB-A14997-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Bacteria |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CAS9 |
| Staphylococcus aureus Cas9 (SaCas9) is an RNA-guided endonuclease that targets complementary DNA adjacent to a protospacer adjacent motif (PAM) for cleavage. Its small size facilitates in vivo delivery for genome editing in various organisms. |
| Klonalität: | Polyclonal |
| NCBI: | 901176 |
| Reinheit: | Affinity purification |
| Sequenz: | YYVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTF |
| Target-Kategorie: | CAS9 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Other (Wide Range Predicted). Shipping: Ice Bag |
|
|
Western blot analysis of extracts of 293T cells and 293T transfected with CAS9 protein, using CAS9 Rabbit pAb (A14997) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 120s. |
Produktgarantie und fachkundiger Support
