REC8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15002
- Bilder (1)
| Artikelname: | REC8 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15002 |
| Hersteller Artikelnummer: | A15002 |
| Alternativnummer: | ABB-A15002-100UL,ABB-A15002-20UL,ABB-A15002-500UL,ABB-A15002-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | mrec, Rec8L1, REC8 |
| Predicted to enable chromatin binding activity. Acts upstream of or within several processes, including gamete generation, seminiferous tubule development, and synaptonemal complex assembly. Located in kinetochore, lateral element, and male germ cell nucleus. Part of nuclear meiotic cohesin complex. Is expressed in several structures, including alimentary system, central nervous system, genitourinary system, respiratory system, and sensory organ. Orthologous to human REC8 (REC8 meiotic recombination protein). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 67kDa |
| NCBI: | 56739 |
| Reinheit: | Affinity purification |
| Sequenz: | EVITLQEAEPIRMLQIEGEQDLPEISRGDLELLIAEKDDAILLEERQRGRLLRQRRASLPLDESREEPRALEGAGLVSALSPPAPAQVEGIQEALPGQVFPPEVQKMTGWEPGALLTEVTPPQELRLPAPPSTEKRLPSLQRPLPRRHRRRQLLFWDKETQISREKFEEQLQTGAHCWEYPVAQPPKRMLTSPAELFRTPTLSGWLPPELLGLWTHCAQVPQRMLRQRPQLETEETVEEERAADEEERRKTEALS |
| Target-Kategorie: | Rec8 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Rat. ResearchArea: Epigenetics & Nuclear Signaling,Cell Biology & Developmental Biology,Cell Cycle. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Rat testis, using REC8 Rabbit pAb (A15002) at 1:3000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
