HMGB3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15064
Artikelname: HMGB3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15064
Hersteller Artikelnummer: A15064
Alternativnummer: ABB-A15064-20UL,ABB-A15064-100UL,ABB-A15064-500UL,ABB-A15064-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HMG4, HMG-4, HMG2A, HMG-2a, HMGB3
This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 23kDa
NCBI: 3149
UniProt: O15347
Reinheit: Affinity purification
Sequenz: MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKFDEMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKRPPSGF
Target-Kategorie: HMGB3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag
Western blot analysis of lysates from Rat thymus, using HMGB3 Rabbit pAb (A15064) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.