PDE7A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15079
Artikelname: PDE7A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15079
Hersteller Artikelnummer: A15079
Alternativnummer: ABB-A15079-20UL,ABB-A15079-100UL,ABB-A15079-1000UL,ABB-A15079-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HCP1, PDE7, PDE7A
The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE7 subfamily. This PDE hydrolyzes the second messenger, cAMP, which is a regulator and mediator of a number of cellular responses to extracellular signals. Thus, by regulating the cellular concentration of cAMP, this protein plays a key role in many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Klonalität: Polyclonal
Molekulargewicht: 56kDa
NCBI: 5150
UniProt: Q13946
Reinheit: Affinity purification
Sequenz: ELSKQWSEKVTEEFFHQGDIEKKYHLGVSPLCDRHTESIANIQIGFMTYLVEPLFTEWARFSNTRLSQTMLGHVGLNKASWKGLQREQSSSEDTDAAFELNSQLLPQENRLS
Target-Kategorie: PDE7A
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using PDE7A Rabbit pAb (A15079) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 10s.