TAS2R38 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15087
Artikelname: TAS2R38 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15087
Hersteller Artikelnummer: A15087
Alternativnummer: ABB-A15087-100UL,ABB-A15087-20UL,ABB-A15087-500UL,ABB-A15087-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PTC, T2R38, T2R61, THIOT, TAS2R38
This gene encodes a seven-transmembrane G protein-coupled receptor that controls the ability to taste glucosinolates, a family of bitter-tasting compounds found in plants of the Brassica sp. Synthetic compounds phenylthiocarbamide (PTC) and 6-n-propylthiouracil (PROP) have been identified as ligands for this receptor and have been used to test the genetic diversity of this gene. Although several allelic forms of this gene have been identified worldwide, there are two predominant common forms (taster and non-taster) found outside of Africa. These alleles differ at three nucleotide positions resulting in amino acid changes in the protein (A49P, A262V, and V296I) with the amino acid combination PAV identifying the taster variant (and AVI identifying the non-taster variant).
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 5726
UniProt: P59533
Reinheit: Affinity purification
Sequenz: CSCICTVLCVWCFFSRPHFTVTTVLFMNNNTRLNWQIKDLNLFYSFLFCYLWSVPPFLLFLVSSGMLTVSLGRHMRTMKVYTRNSRDPSLEAHIKALKSLV
Target-Kategorie: TAS2R38
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Rat. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from rat thymus, using TAS2R38 Rabbit pAb (A15087) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.