RPL6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15094
Artikelname: RPL6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15094
Hersteller Artikelnummer: A15094
Alternativnummer: ABB-A15094-100UL,ABB-A15094-20UL,ABB-A15094-500UL,ABB-A15094-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: L6, eL6, TXREB1, SHUJUN-2, TAXREB107, RPL6
This gene encodes a protein component of the 60S ribosomal subunit. This protein can bind specifically to domain C of the tax-responsive enhancer element of human T-cell leukemia virus type 1, and may participate in tax-mediated transactivation of transcription. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed throughout the genome. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 33kDa
NCBI: 6128
UniProt: Q02878
Reinheit: Affinity purification
Sequenz: RTHQKFVIATSTKIDISNVKIPKHLTDAYFKKKKLRKPRHQEGEIFDTEKEKYEITEQRKIDQKAVDSQILPKIKAIPQLQGYLRSVFALTNGIYPHKLVF
Target-Kategorie: RPL6
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag
Western blot analysis of various lysates using RPL6 Rabbit pAb (A15094) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.