TBL1X Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15102
Artikelname: TBL1X Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15102
Hersteller Artikelnummer: A15102
Alternativnummer: ABB-A15102-100UL,ABB-A15102-20UL,ABB-A15102-1000UL,ABB-A15102-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: EBI, TBL1, CHNG8, SMAP55, TBL1X
The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate protein-protein interactions and members of the family are involved in signal transduction, RNA processing, gene regulation, vesicular trafficking, cytoskeletal assembly and may play a role in the control of cytotypic differentiation. This encoded protein is found as a subunit in corepressor SMRT (silencing mediator for retinoid and thyroid receptors) complex along with histone deacetylase 3 protein. This gene is located adjacent to the ocular albinism gene and it is thought to be involved in the pathogenesis of the ocular albinism with late-onset sensorineural deafness phenotype. Four transcript variants encoding two different isoforms have been found for this gene. This gene is highly similar to the Y chromosome TBL1Y gene.
Klonalität: Polyclonal
Molekulargewicht: 62kDa
NCBI: 6907
UniProt: O60907
Reinheit: Affinity purification
Sequenz: LISILQKGLQYVEAEISINEDGTVFDGRPIESLSLIDAVMPDVVQTRQQAFREKLAQQQASAAAAAAAATAAATAATTTSAGVSHQNPSKNREATVNGEEN
Target-Kategorie: TBL1X
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Cancer,Endocrine Metabolism,Lipid Metabolism,Endocrine and metabolic diseases,Diabetes,Obesity,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using TBL1X Rabbit pAb (A15102) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.