RTN3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15129
- Bilder (1)
| Artikelname: | RTN3 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15129 |
| Hersteller Artikelnummer: | A15129 |
| Alternativnummer: | ABB-A15129-20UL,ABB-A15129-100UL,ABB-A15129-1000UL,ABB-A15129-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HAP, ASYIP, NSPL2, NSPLII, RTN3-A1, RTN3 |
| This gene belongs to the reticulon family of highly conserved genes that are preferentially expressed in neuroendocrine tissues. This family of proteins interact with, and modulate the activity of beta-amyloid converting enzyme 1 (BACE1), and the production of amyloid-beta. An increase in the expression of any reticulon protein substantially reduces the production of amyloid-beta, suggesting that reticulon proteins are negative modulators of BACE1 in cells. Alternatively spliced transcript variants encoding different isoforms have been found for this gene, and pseudogenes of this gene are located on chromosomes 4 and 12. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 113kDa |
| NCBI: | 10313 |
| UniProt: | O95197 |
| Reinheit: | Affinity purification |
| Sequenz: | YKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE |
| Target-Kategorie: | RTN3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from HeLa cells, using RTN3 Rabbit pAb (A15129) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
