PEN2/PSENEN Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15172
Artikelname: PEN2/PSENEN Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15172
Hersteller Artikelnummer: A15172
Alternativnummer: ABB-A15172-20UL,ABB-A15172-100UL,ABB-A15172-1000UL,ABB-A15172-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PEN2, PEN-2, MDS033, ACNINV2, MSTP064, PEN2/PSENEN
Presenilins, which are components of the gamma-secretase protein complex, are required for intramembranous processing of some type I transmembrane proteins, such as the Notch proteins and the beta-amyloid precursor protein. Signaling by Notch receptors mediates a wide range of developmental cell fates. Processing of the beta-amyloid precursor protein generates neurotoxic amyloid beta peptides, the major component of senile plaques associated with Alzheimers disease. This gene encodes a protein that is required for Notch pathway signaling, and for the activity and accumulation of gamma-secretase. Mutations resulting in haploinsufficiency for this gene cause familial acne inversa-2 (ACNINV2). Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 12 kDa
NCBI: 55851
UniProt: Q9NZ42
Reinheit: Affinity purification
Sequenz: MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP
Target-Kategorie: PSENEN
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,ESC Pluripotency and Differentiation,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease,Neurodegenerative Diseases Markers. Shipping: Ice Bag
Western blot analysis of lysates from Mouse spleen, using PEN2/PSENEN Rabbit pAb (A15172) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.