GEMIN7 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15189
- Bilder (1)
| Artikelname: | GEMIN7 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15189 |
| Hersteller Artikelnummer: | A15189 |
| Alternativnummer: | ABB-A15189-20UL,ABB-A15189-100UL,ABB-A15189-500UL,ABB-A15189-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SIP3, GEMIN7 |
| The protein encoded by this gene is a component of the core SMN complex, which is required for pre-mRNA splicing in the nucleus. The encoded protein is found in the nucleoplasm, in nuclear gems (Gemini of Cajal bodies), and in the cytoplasm. Three transcript variants encoding the same protein have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 15kDa |
| NCBI: | 79760 |
| UniProt: | Q9H840 |
| Reinheit: | Affinity purification |
| Sequenz: | MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP |
| Target-Kategorie: | GEMIN7 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from HeLa cells, using GEMIN7 Rabbit pAb (A15189) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
